{"product_id":"proteintech-30716-1-ap","title":"Proteintech, 30716-1-AP, MAP4K3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MAP4K3 (30716-1-AP) by Proteintech is a Polyclonal antibody targeting MAP4K3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n30716-1-AP targets MAP4K3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-87 MG cells, mouse brain tissue,  rat brain tissue\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U-87 MG cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMAP4K3(Mitogen-activated protein kinase kinase kinase kinase 3) has kinase activity and that it activates JNK but not MAPK1, MAPK3 or MAPK14 through the activation of MAP3K1 and MAP2K4. Endogenous MAP4K3 kinase activity could be stimulated by exposure to ultraviolet radiation or to tumor necrosis factor.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33512 Product name: Recombinant human MAP4K3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 345-515 aa of BC071579 Sequence: ETEPHHELDLQLEYGQGHQGGYFLGANKSLLKSVEEELHQRGHVAHLEDDEGDDDESKHSTLKAKIPPPLPPKPKSIFIPQEMHSTEDENQGTIKRCPMSGSPAKPSQVPPRPPPPRLPPHKPVALGNGMSSFQLNGERDGSLCQQQNEHRGTNLSRKEKKDVPKPISNGL Predict reactive species\nFull Name: mitogen-activated protein kinase kinase kinase kinase 3\nCalculated Molecular Weight: 101 kDa\nObserved Molecular Weight: 99-101 kDa\nGenBank Accession Number: BC071579\nGene Symbol: MAP4K3\nGene ID (NCBI): 8491\nRRID: AB_3086398\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IVH8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887712817321,"sku":"30716-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30716-1-ap","provider":"Iright","version":"1.0","type":"link"}