{"product_id":"proteintech-30717-1-ap","title":"Proteintech, 30717-1-AP, SATB2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SATB2 (30717-1-AP) by Proteintech is a Polyclonal antibody targeting SATB2 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n30717-1-AP targets SATB2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse brain tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSATB2, also named as KIAA1034, belongs to the CUT homeobox family. SATB2 binds to DNA at nuclear matrix- or scaffold-associated regions. STAB2 recognizes the sugar-phosphate structure of double-stranded DNA. SATB2 is a transcription factor controlling nuclear gene expression, by binding to matrix attachment regions (MARs) of DNA and inducing a local chromatin-loop remodeling. SATB2 acts as a docking site for several chromatin remodeling enzymes and also by recruiting corepressors (HDACs) or coactivators (HATs) directly to promoters and enhancers. It is required for the initiation of the upper-layer neurons (UL1) specific genetic program and for the inactivation of deep-layer neurons (DL) and UL2 specific genes, probably by modulating BCL11B expression. It is a repressor of Ctip2 and regulatory determinant of corticocortical connections in the developing cerebral cortex. SATB2 may play an important role in palate formation. SATB2 acts as a molecular node in a transcriptional network regulating skeletal development and osteoblast differentiation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33523 Product name: Recombinant human SATB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 674-733 aa of BC098136 Sequence: GKLKEHLGSAVDVAEYKDEELLTESEENDSEEGSEEMYKVEAEEENADKSKAAPAEIDQR Predict reactive species\nFull Name: SATB homeobox 2\nCalculated Molecular Weight: 733 aa, 83 kDa\nObserved Molecular Weight: 90 kDa\nGenBank Accession Number: BC098136\nGene Symbol: SATB2\nGene ID (NCBI): 23314\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UPW6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887792836777,"sku":"30717-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30717-1-ap","provider":"Iright","version":"1.0","type":"link"}