{"product_id":"proteintech-30763-1-ap","title":"Proteintech, 30763-1-AP, PTPRM\/RPTPmu Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTPRM\/RPTPmu (30763-1-AP) by Proteintech is a Polyclonal antibody targeting PTPRM\/RPTPmu in WB, ELISA applications with reactivity to human, rat samples\n30763-1-AP targets PTPRM\/RPTPmu in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, MDA-MB-231 cells,  U-87 MG cells,  rat eye tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPTPRM, also known as protein tyrosine phosphatase receptor type M or RPTPmu, is a protein with a molecular weight of approximately 155 kDa. It is a receptor-type tyrosine phosphatase involved in cell-cell adhesion, migration, and signaling. It exists in two forms, either a full-length 200 kDa form or as two noncovalently associated fragments of 100 kDa each.Additional unidentified serine proteases cleave PTPμ in GBM cells to yield smaller extracellular fragments with MWs of 78 and 55 kDa (PMID: 25223585).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33475 Product name: Recombinant human PTPRM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 765-880 aa of NM_002845 Sequence: KKRKLAKKRKETMSSTRQEMTVMVNSMDKSYAEQGTNCDEAFSFMDTHNLNGRSVSSPSSFTMKTNTLSTSVPNSYYPDETHTMASDTSSLVQSHTYKKREPADVPYQTGQLHPAI Predict reactive species\nFull Name: protein tyrosine phosphatase, receptor type, M\nCalculated Molecular Weight: 164KD\nObserved Molecular Weight: 80 kDa, 100 kDa, 200 kDa\nGenBank Accession Number: NM_002845\nGene Symbol: PTPRM\nGene ID (NCBI): 5797\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P28827\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887777304745,"sku":"30763-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30763-1-ap","provider":"Iright","version":"1.0","type":"link"}