{"product_id":"proteintech-30768-1-ap","title":"Proteintech, 30768-1-AP, Cyclin E2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cyclin E2 (30768-1-AP) by Proteintech is a Polyclonal antibody targeting Cyclin E2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n30768-1-AP targets Cyclin E2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, NIH\/3T3 cells,  mouse testis tissue,  rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCyclin E2 (CCNE2) belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughout the cell cycle. Cyclins function as regulators of cyclindependent kinases (CDKs). Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of cell cycle events. CCNE2 forms a complex with and functions as a regulatory subunit of CDK2 and has been shown to specifically interact with CIP\/KIP family of CDK inhibitors. CCNE2 plays a role in cell cycle G1\/S transition and its expression peaks at the G1-S phase. Whereas cyclin E1 is expressed in most proliferating normal and tumor cells, cyclin E2 levels are low or undetectable in nontransformed cells, and are elevated in tumor-derived cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26029 Product name: Recombinant human CCNE2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC020729 Sequence: MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQM Predict reactive species\nFull Name: cyclin E2\nCalculated Molecular Weight: 374 aa, 44 kDa\nObserved Molecular Weight: 44 kDa\nGenBank Accession Number: BC020729\nGene Symbol: CCNE2\nGene ID (NCBI): 9134\nRRID: AB_3086415\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O96020\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886993264809,"sku":"30768-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30768-1-ap","provider":"Iright","version":"1.0","type":"link"}