{"product_id":"proteintech-30841-1-ap","title":"Proteintech, 30841-1-AP, MAPKAPK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MAPKAPK2 (30841-1-AP) by Proteintech is a Polyclonal antibody targeting MAPKAPK2 in WB, ELISA applications with reactivity to human samples\n30841-1-AP targets MAPKAPK2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Calu-1 cells,  HeLa cells,  Hepg2 cells,  L02 cells,  SW480 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMAPKAPK2(mitogen-activated protein kinase-activated protein kinase 2) is also named as MK2, MAPKAP-K2, MK-2 and belongs to the CAMK Ser\/Thr protein kinase family. MAPKAPK2, one of several kinases directly phosphorylated and activated by p38 MAPK, plays a central role in the inflammatory response and is in the nucleus of unstimulated cells and moves rapidly to the cytoplasm after stimulation(PMID:12171911). It is also involved in many other cellular processes including stress responses, nuclear export, gene expression regulation and cell proliferation. Multiple residues of MAPKAPK2 are generally phosphorylated in vivo in response to stress, but only 4 residues(Thr25, Thr222, Ser272, and Thr334) are phosphorylated by p38 MAPK in vitro(PMID:22351694). It has 2 isoforms produced by alternative splicing and the range of the molecular weight is 42-60 kDa according to the references(PMID:10666409; 11328854;8995385).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34196 Product name: Recombinant human MAPKAPK2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-120 aa of BC036060 Sequence: MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRI Predict reactive species\nFull Name: mitogen-activated protein kinase-activated protein kinase 2\nCalculated Molecular Weight: 400 aa, 46 kDa\nObserved Molecular Weight: 42-60 kDa\nGenBank Accession Number: BC036060\nGene Symbol: MAPKAPK2\nGene ID (NCBI): 9261\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P49137\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887713177769,"sku":"30841-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30841-1-ap","provider":"Iright","version":"1.0","type":"link"}