{"product_id":"proteintech-30848-1-ap","title":"Proteintech, 30848-1-AP, NPY5R Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NPY5R (30848-1-AP) by Proteintech is a Polyclonal antibody targeting NPY5R in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n30848-1-AP targets NPY5R in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spinal cord tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: BxPC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeuropeptide Y receptor Y5 (NPY5R) is a G protein-coupled receptor (GPCR) that belongs to the neuropeptide Y receptor family and is primarily involved in regulating food intake, energy metabolism, and various physiological processes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5428 Product name: Recombinant human NPY5R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 240-382 aa of BC042416 Sequence: CGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWM Predict reactive species\nFull Name: neuropeptide Y receptor Y5\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC042416\nGene Symbol: NPY5R\nGene ID (NCBI): 4889\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q15761\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887741718697,"sku":"30848-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30848-1-ap","provider":"Iright","version":"1.0","type":"link"}