{"product_id":"proteintech-30850-1-ap","title":"Proteintech, 30850-1-AP, COL4A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COL4A1 (30850-1-AP) by Proteintech is a Polyclonal antibody targeting COL4A1 in WB, IHC, ELISA applications with reactivity to human samples\n30850-1-AP targets COL4A1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, SK-N-SH cells\nPositive IHC detected in: Hepatocellular carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOL4A1 (Collagen Type IV Alpha 1 Chain)  encodes a major component of type IV collagen, which is an essential structural element of basement membranes in various tissues. COL4A1 forms heterotrimers with other collagen type IV chains (e.g., COL4A2) and interacts with extracellular matrix components such as laminins, proteoglycans, and perlecans. Proteolytic cleavage of the non-collagenous domain of COL4A1 produces a fragment called arresten, which has anti-angiogenic and tumor suppressor properties. Elevated expression of COL4A1 has been observed in various cancers, including hepatocellular carcinoma (HCC), where it promotes tumor growth and metastasis through the FAK-Src signaling pathway. COL4A1 is highly expressed in various tissues, including the placenta, fat, and other organs. The expression of COL4A1 can be regulated by transcription factors such as RUNX1, which has been shown to upregulate COL4A1 in hepatocellular carcinoma. The molecular weight of OSBPL5 is 160 kDa, and it also has glycosylation modification.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34391 Product name: Recombinant human COL4A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 901-1110 aa of BC151220 Sequence: LPGEKGDHGFPGSSGPRGDPGLKGDKGDVGLPGKPGSMDKVDMGSMKGQKGDQGEKGQIGPIGEKGSRGDPGTPGVPGKDGQAGQPGQPGPKGDPGISGTPGAPGLPGPKGSVGGMGLPGTPGEKGVPGIPGPQGSPGLPGDKGAKGEKGQAGPPGIGIPGLRGEKGDQGIAGFPGSPGEKGEKGSIGIPGMPGSPGLKGSPGSVGYPGS Predict reactive species\nFull Name: collagen, type IV, alpha 1\nCalculated Molecular Weight: 1669 aa, 161 kDa\nObserved Molecular Weight: 160-220 kDa\nGenBank Accession Number: BC151220\nGene Symbol: COL4A1\nGene ID (NCBI): 1282\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P02462\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869453766825,"sku":"30850-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30850-1-ap","provider":"Iright","version":"1.0","type":"link"}