{"product_id":"proteintech-30863-1-ap","title":"Proteintech, 30863-1-AP, GPR52 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR52 (30863-1-AP) by Proteintech is a Polyclonal antibody targeting GPR52 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n30863-1-AP targets GPR52 in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse small intestine tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPR52, or G protein-coupled receptor 52, is an orphan G protein-coupled receptor (GPCR) that constitutively increases cellular cAMP levels and is coupled to the Gs protein, which activates adenylate cyclase. Agonism of GPR52 has been proposed as a therapeutic intervention for the psychotic and cognitive aspects of schizophrenia. Its role in modulating neurotransmission and the identification of ligands that can interact with it highlight its potential in therapeutic development.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31188 Product name: Recombinant human GPR52 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC067456 Sequence: MNESRWTEWRILNMSSGIVNVSERHSCPLGFGHYSVVDVCIFETVVIVLLTFLIIAGNLTVIFVF Predict reactive species\nFull Name: G protein-coupled receptor 52\nCalculated Molecular Weight: 361 aa, 41 kDa\nGenBank Accession Number: BC067456\nGene Symbol: GPR52\nGene ID (NCBI): 9293\nRRID: AB_3669768\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2T5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887657898153,"sku":"30863-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30863-1-ap","provider":"Iright","version":"1.0","type":"link"}