{"product_id":"proteintech-30865-1-ap","title":"Proteintech, 30865-1-AP, MEX3A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MEX3A (30865-1-AP) by Proteintech is a Polyclonal antibody targeting MEX3A in WB, IF\/ICC, ELISA applications with reactivity to human samples\n30865-1-AP targets MEX3A in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, SH-SY5Y cells,  SKOV-3 cells,  HCT 116 cells\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMEX3A is a member of the MEX3 family, which widely exists in mammalian cells and encodes four different genes, MEX3A, MEX3B, MEX3C, and MEX3D. The MEX3 protein of mammals is composed of two RNA-binding KH domains and a ring domain with E3 ubiquitin ligase activity at the C terminal. The ring finger domain endows human MEX3 protein the ability to regulate ubiquitination of target proteins and then influencing their protein stability and subcellular localization.MEX3A plays complex and diverse roles in the development of various cancers. MEX3A plays a pivotal role in the post-transcriptional procession of mRNA and gene expression. MEX3A gene expression may be closely connected with malignant tumor development and progression. In most literature, MEX3A detects molecular weights between 60 and 70kDa (PMID:33159833,37845346,36354374,35490173,34976441,33159833)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33619 Product name: Recombinant human MEX3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 285-480 aa of NM_001093725 Sequence: ETHIAVRTGKILEYNNENDFLAGSPDAAIDSRYSDAWRVHQPGCKPLSTFRQNSLGCIGECGVDSGFEAPRLGEQGGDFGYGGYLFPGYGVGKQDVYYGVAETSPPLWAGQENATPTSVLFSSASSSSSSSAKARAGPPGAHRSPATSAGPELAGLPRRPPGEPLQGFSKLGGGGLRSPGGGRDCMVCFESEVTAA Predict reactive species\nFull Name: mex-3 homolog A (C. elegans)\nCalculated Molecular Weight: 54 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: NM_001093725\nGene Symbol: MEX3A\nGene ID (NCBI): 92312\nRRID: AB_3086425\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: A1L020\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887718027433,"sku":"30865-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30865-1-ap","provider":"Iright","version":"1.0","type":"link"}