{"product_id":"proteintech-30909-1-ap","title":"Proteintech, 30909-1-AP, COQ2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COQ2 (30909-1-AP) by Proteintech is a Polyclonal antibody targeting COQ2 in WB, ELISA applications with reactivity to Human samples\n30909-1-AP targets COQ2 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, U-87 MG cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOQ2 (coenzyme Q2, polyprenyltransferase), also known as CL640. It is expected to be located in mitochondrion inner membrane. And the protein is highly expressed in skeletal muscle, adrenal glands and the heart. COQ2 is a redox carrier in the mitochondrial respiratory chain and a lipid-soluble antioxidant. This enzyme, which is part of the coenzyme Q10 pathway, catalyzes the prenylation of parahydroxybenzoate with an all-trans polyprenyl group. Mutations in this gene cause coenzyme Q10 deficiency, a mitochondrial encephalomyopathy, and also COQ2 nephropathy, an inherited form of mitochondriopathy with primary renal involvement. The protein has three isforms, the calculated molecular weight are 35, 40, 45 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29155 Product name: Recombinant human COQ2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 35-146 aa of BC008804 Sequence: AGAPHGGDLQPPACPEPRGRQLSLSAAAVVDSAPRPLQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEPGCFPDWYMLSLFGTGAILMRGAGCTINDMWDQDYDKKVTRTAN Predict reactive species\nFull Name: coenzyme Q2 homolog, prenyltransferase (yeast)\nCalculated Molecular Weight: 371 aa, 40 kDa\nObserved Molecular Weight: 35 kDa，40 kDa，45 kDa\nGenBank Accession Number: BC008804\nGene Symbol: COQ2\nGene ID (NCBI): 27235\nRRID: AB_3669780\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96H96\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886817497257,"sku":"30909-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30909-1-ap","provider":"Iright","version":"1.0","type":"link"}