{"product_id":"proteintech-30922-1-ap","title":"Proteintech, 30922-1-AP, SPP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPP2 (30922-1-AP) by Proteintech is a Polyclonal antibody targeting SPP2 in WB, ELISA applications with reactivity to human samples\n30922-1-AP targets SPP2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPP2 (Secreted phosphoprotein 24), also known as SPP24. SPP2 is a secreted phosphoprotein, which was originally isolated and purified from bovine bone density. It is widely distributed in the body, mainly produced in the liver and transported to other tissues. SPP2 is expressed in many tissues, especially in the liver. Studies have shown that the expression level of SPP2 is up-regulated in liver cirrhosis. In addition, the expression of SPP2 is significantly related to many genes, including APOA1, SLC2A2 and TTR (PMID: 38448371). SPP2 has many biological functions, including: it can inhibit the activity of cysteine protease, participate in bone formation, inhibit calcification, and regulate BMP\/TGF-β signaling pathway. SPP2 may be a tumor suppressor, which inhibits the development of HCC by inhibiting BMP\/TGF-β signaling pathway. The molecular weight of SPP2 is 24 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29299 Product name: Recombinant human SPP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-211 aa of NM_006944 Sequence: FPVYDYDPSSLRDALSASVVKVNSQSLSPYLFRAFRSSLKRVEVLDENNLVMNLEFSIRETTCRKDSGEDPATCAFQRDYYVSTAVCRSTVKVSAQQVQGVHARCSWSSSTSESYSSEEMIFGDMLGSHKWRNNYLFGLISDESISEQFYDRSLGIMRRVLPPGNRRYPNHRHRARINTDFE Predict reactive species\nFull Name: secreted phosphoprotein 2, 24kDa\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: NM_006944\nGene Symbol: SPP2\nGene ID (NCBI): 6694\nRRID: AB_3669785\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13103\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887815250089,"sku":"30922-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30922-1-ap","provider":"Iright","version":"1.0","type":"link"}