{"product_id":"proteintech-30975-1-ap","title":"Proteintech, 30975-1-AP, OPN1MW Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OPN1MW (30975-1-AP) by Proteintech is a Polyclonal antibody targeting OPN1MW in WB, ELISA applications with reactivity to human, mouse, rat samples\n30975-1-AP targets OPN1MW in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOPN1MW (opsin 1, medium wave sensitive), also known as CBD. It is expected to be located in cell membrane. This gene encodes for a light absorbing visual pigment of the opsin gene family. The encoded protein is called green cone photopigment or medium-wavelength sensitive opsin. Opsins are G-protein coupled receptors with seven transmembrane domains, an N-terminal extracellular domain, and a C-terminal cytoplasmic domain. The long-wavelength opsin gene and multiple copies of the medium-wavelength opsin gene are tandemly arrayed on the X chromosome and frequent unequal recombination and gene conversion may occur between these sequences. X chromosomes may have fusions of the medium- and long-wavelength opsin genes or may have more than one copy of these genes. Defects in this gene are the cause of deutanopic colorblindness. The calculated molecular weight of OPN1MW is 40 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34169 Product name: Recombinant human OPN1MW protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-52 aa of BC156776 Sequence: MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWV Predict reactive species\nFull Name: opsin 1 (cone pigments), medium-wave-sensitive\nObserved Molecular Weight: 38-40 kDa\nGenBank Accession Number: BC156776\nGene Symbol: OPN1MW\nGene ID (NCBI): 2652\nRRID: AB_3669801\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P04001\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869722333353,"sku":"30975-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30975-1-ap","provider":"Iright","version":"1.0","type":"link"}