{"product_id":"proteintech-30977-1-ap","title":"Proteintech, 30977-1-AP, FMO1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FMO1 (30977-1-AP) by Proteintech is a Polyclonal antibody targeting FMO1 in IHC, ELISA applications with reactivity to human, mouse samples\n30977-1-AP targets FMO1 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human liver tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFlavin-containing monooxygenase 1 (FMO1) belongs to the FMO family. FMO1 is an enzyme that catalyzes the oxygenation of a series of sulfur-containing and nitrogen-containing substrates, and thus is involved in a series of drugs and xenobiotics metabolism. FMO1 can regulate PPAR-α and mediate metabolic processes. FMO1 is expressed at relatively high levels in human fetal liver and also represents the major FMO enzyme in the adult human and rabbit intestine and kidney (PMID: 11809920, 30757917, 37553313). Human FMO1 has 2 isoforms with the molecular weights of 53 kDa and 60 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34267 Product name: Recombinant human FMO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-430 aa of NM_001282692 Sequence: LLKHIQFKTKVCSVTKCSDSAVSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQNMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIRPSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAHLQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWFGLCYCKALQS Predict reactive species\nFull Name: flavin containing monooxygenase 1\nCalculated Molecular Weight: 60 kDa\nGenBank Accession Number: NM_001282692\nGene Symbol: FMO1\nGene ID (NCBI): 2326\nRRID: AB_3669802\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q01740\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887641710761,"sku":"30977-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30977-1-ap","provider":"Iright","version":"1.0","type":"link"}