{"product_id":"proteintech-30984-1-ap","title":"Proteintech, 30984-1-AP, BAZ2A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BAZ2A (30984-1-AP) by Proteintech is a Polyclonal antibody targeting BAZ2A in WB, ELISA applications with reactivity to Human, mouse samples\n30984-1-AP targets BAZ2A in WB, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  PC-3 cells,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBAZ2A (bromodomain adjacent to zinc finger domain 2A), also known as TIP5. It is expected to be located in nucleus, and the protein is expressed at moderate levels in most tissues analyzed, including heart, brain, placenta, lung, skeletal muscle, kidney and pancreas. BAZ2A is an epigenetic regulator affecting transcription of ribosomal RNA, it is also a regulatory subunit of the ATP-dependent NoRC-1 and NoRC-5 ISWI chromatin remodeling complexes, which form ordered nucleosome arrays on chromatin and facilitate access to DNA during DNA-templated processes such as DNA replication, transcription, and repair (PubMed:28801535). The calculated molecular weight of BAZ2A is 210 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33963 Product name: Recombinant human BAZ2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 97-295 aa of NM_013449.4 Sequence: QYPSANPGSNLKDPPLLSQFSGGQYPLNGILGGSRQPSSPSHNTNLRAGSQEFWANGTQSPMGLNFDSQELYDSFPDQNFEVMPNGPPSFFTSPQTSPMLGSSIQTFAPSQEVGSGIHPDEAAEKEMTSVVAENGTGLVGSLELEEEQPELKMCGYNGSVPSVESLHQEVSVLVPDPTVSCLDDPSHLPDQLEDTPILS Predict reactive species\nFull Name: bromodomain adjacent to zinc finger domain, 2A\nCalculated Molecular Weight: 211 kDa\nObserved Molecular Weight: 250-270 kDa\nGenBank Accession Number: NM_013449.4\nGene Symbol: BAZ2A\nGene ID (NCBI): 11176\nRRID: AB_3669805\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9UIF9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885182341289,"sku":"30984-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-30984-1-ap","provider":"Iright","version":"1.0","type":"link"}