{"product_id":"proteintech-31006-1-ap","title":"Proteintech, 31006-1-AP, FAM46A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM46A (31006-1-AP) by Proteintech is a Polyclonal antibody targeting FAM46A in WB, ELISA applications with reactivity to human samples\n31006-1-AP targets FAM46A in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM46A, also known as TENT5A, is a member of the FAM46 subfamily of the nucleotidyltransferase fold superfamily. It has two isoforms and has been implicated in several human diseases including retinitis pigmentosa, bone abnormalities, cancer and obesity (PMID: 32528962).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33896 Product name: Recombinant human FAM46A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-82 aa of BC000683 Sequence: MAEGEGYFAMSEDELACSPYIPLGGDFGGGDFGGGDFGGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQVQRLDGILSETI Predict reactive species\nFull Name: family with sequence similarity 46, member A\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC000683\nGene Symbol: FAM46A\nGene ID (NCBI): 55603\nRRID: AB_3669813\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96IP4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887632896169,"sku":"31006-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31006-1-ap","provider":"Iright","version":"1.0","type":"link"}