{"product_id":"proteintech-31019-1-ap","title":"Proteintech, 31019-1-AP, SLC35D1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC35D1 (31019-1-AP) by Proteintech is a Polyclonal antibody targeting SLC35D1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n31019-1-AP targets SLC35D1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC35D1 belongs to the TPT transporter family and is a nucleotide sugar transporter (NST) expressed in the endoplasmic reticulum. Loss-of-function mutations in SLC35D1 cause Schneckenbecken dysplasia, a severe skeletal dysplasia (PMID: 19508970; 35934917).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34372 Product name: Recombinant human SLC35D1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 89-157 aa of BC093786 Sequence: VGKALRVVKFPDLDRNVPRKTFPLPLLYFGNQITGLFSTKKLNLPMFTVLRRFSILFTMFAEGVLLKKT Predict reactive species\nFull Name: solute carrier family 35 (UDP-glucuronic acid\/UDP-N-acetylgalactosamine dual transporter), member D1\nCalculated Molecular Weight: 355 aa, 39 kDa\nObserved Molecular Weight: 35-39 kDa\nGenBank Accession Number: BC093786\nGene Symbol: SLC35D1\nGene ID (NCBI): 23169\nRRID: AB_3669816\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9NTN3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887806173353,"sku":"31019-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31019-1-ap","provider":"Iright","version":"1.0","type":"link"}