{"product_id":"proteintech-31061-1-ap","title":"Proteintech, 31061-1-AP, IFI35 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IFI35 (31061-1-AP) by Proteintech is a Polyclonal antibody targeting IFI35 in WB, ELISA applications with reactivity to Human samples\n31061-1-AP targets IFI35 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  Jurkat cells,  SW480 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIFI35 (interferon induced protein 35), also known as IFP35. It is expected to be located in cytoplasm, nucleus and extracellular space. The protein is expressed in a wide range of cell types, including fibroblasts, macrophages, and epithelial cells. Involved in several processes, including macrophage activation involved in immune response; positive regulation of defense response; and regulation of signal transduction. And the calculated molecular weight of IFI35 is 31 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34653 Product name: Recombinant human IFI35 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-203 aa of BC001356 Sequence: RKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQVMVSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVP Predict reactive species\nFull Name: interferon-induced protein 35\nCalculated Molecular Weight: 31 kDa\nObserved Molecular Weight: 31-35 kDa\nGenBank Accession Number: BC001356\nGene Symbol: IFI35\nGene ID (NCBI): 3430\nRRID: AB_3669837\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P80217\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887676018857,"sku":"31061-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31061-1-ap","provider":"Iright","version":"1.0","type":"link"}