{"product_id":"proteintech-31063-1-ap","title":"Proteintech, 31063-1-AP, SMOC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMOC2 (31063-1-AP) by Proteintech is a Polyclonal antibody targeting SMOC2 in WB, ELISA applications with reactivity to human, mouse samples\n31063-1-AP targets SMOC2 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, mouse brain tissue,  mouse ovary tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSecreted modular calcium-binding protein 2 (SMOC2), which is a member of the secreted protein acidic and rich in cysteine (SPARC) family of matricellular proteins, interacts with matrix proteins, cell surface receptors, cytokines, proteasomes and other effector molecules to regulate cell-cell and cell-microenvironment communication (PMID: 36513634). It is expected to be located in extracellular space. The calculated molecular weight of SMOC2 is 50 kDa. In recent years, SMOC2 has been reported to be highly expressed in tumor tissues and to promote tumor migration, invasion and growth. In addition to its role in tumor progression, it also regulates wound healing, bone growth, fibrosis and embryogenesis (PMID: 36513634).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34966 Product name: Recombinant human SMOC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-230 aa of BC047583 Sequence: QKFSALTFLRVDQDKDKDCSLDCAGSPQKPLCASDGRTFLSRCEFQRAKCKDPQLEIAYRGNCKDVSRCVAERKYTQEQARKEFQQVFIPECNDDGTYSQVQCHSYTGYCWCVTPNGRPISGTAVAHKTPRCPGSVNEKLPQREGTGKTDDAAAPALETQPQGDEEDIASRYPTLWTEQVKSRQNKTNKNSVSSCDQEHQSALEEAKQP Predict reactive species\nFull Name: SPARC related modular calcium binding 2\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 49-50 kDa\nGenBank Accession Number: BC047583\nGene Symbol: SMOC2\nGene ID (NCBI): 64094\nRRID: AB_3669838\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9H3U7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887810007209,"sku":"31063-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31063-1-ap","provider":"Iright","version":"1.0","type":"link"}