{"product_id":"proteintech-31098-1-ap","title":"Proteintech, 31098-1-AP, EGR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EGR1 (31098-1-AP) by Proteintech is a Polyclonal antibody targeting EGR1 in WB, ELISA applications with reactivity to Human samples\n31098-1-AP targets EGR1 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEGR1, also named as Early growth response protein 1, is a 543 amino acid protein, which belongs to the EGR C2H2-type zinc-finger protein family. EGR1 as a transcriptional regulator recognizes and binds to the DNA sequence 5'-GCG(T\/G)GGGCG-3'(EGR-site) in the promoter region of target genes and binds double-stranded target DNA, irrespective of the cytosine methylation status. EGR1 regulates the transcription of numerous target genes, and thereby plays an important role in regulating the response to growth factors, DNA damage, and ischemia. EGR1 activates expression of p53\/TP53 and TGFB1, and thereby helps prevent tumor formation and plays a role in the regulation of cell survival, proliferation and cell death. Egr1 is suggested to be a 55-kDa protein according to the translation of its coding sequence. Analysis of cytoplasmic and nuclear fractions of normal and irradiated native CNS tissue by Western blotting revealed a 110-kDa band for Egr1 localized in the cytoplasm and a 75-kDa version for the nuclear Egr1(PMID: 17497096)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33440 Product name: Recombinant human EGR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 414-543 aa of BC073983 Sequence: HTKIHLRQKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC* Predict reactive species\nFull Name: early growth response 1\nCalculated Molecular Weight: 543 aa, 58 kDa\nObserved Molecular Weight: 70-80 kDa\nGenBank Accession Number: BC073983\nGene Symbol: EGR1\nGene ID (NCBI): 1958\nRRID: AB_3669855\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P18146\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887449428137,"sku":"31098-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31098-1-ap","provider":"Iright","version":"1.0","type":"link"}