{"product_id":"proteintech-31150-1-ap","title":"Proteintech, 31150-1-AP, TBL3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TBL3 (31150-1-AP) by Proteintech is a Polyclonal antibody targeting TBL3 in WB, IF\/ICC, ELISA applications with reactivity to Human, mouse samples\n31150-1-AP targets TBL3 in WB, IF\/ICC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  Jurkat cells,  mouse testis tissue\nPositive IF\/ICC detected in: A431 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTransducin (beta)-like 3 (TBL3) is a protein of 808 amino acids with an apparent molecular weight of 89 kilodaltons.In mice, Tbl3 is a newly recognized nucleolar protein with regulatory roles in ribosome biogenesis (doi: 10.5315\/wjh.v3.i3.93). In zebrafish, Tbl3 plays a tissue-specific role in regulating cell cycle rate during development(PMID: 22659140).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34900 Product name: Recombinant human TBL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 591-720 aa of BC010231 Sequence: TIKNNECVRTLDAHEDKVWGLHCSRLDDHALTGASDSRVILWKDVTEAEQAEEQARQEEQVVRQQELDNLLHEKRYLRALGLAISLDRPHTVLTVIQAIRRDPEACEKLEATMLRLRRDQKEALLRFCVT Predict reactive species\nFull Name: transducin (beta)-like 3\nCalculated Molecular Weight: 89 kDa\nObserved Molecular Weight: 89 kDa\nGenBank Accession Number: BC010231\nGene Symbol: TBL3\nGene ID (NCBI): 10607\nRRID: AB_3669872\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q12788\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887824031913,"sku":"31150-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31150-1-ap","provider":"Iright","version":"1.0","type":"link"}