{"product_id":"proteintech-31166-1-ap","title":"Proteintech, 31166-1-AP, MMGT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MMGT1 (31166-1-AP) by Proteintech is a Polyclonal antibody targeting MMGT1 in WB, ELISA applications with reactivity to human samples\n31166-1-AP targets MMGT1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MDA-MB-468 cells, PC-3 cells,  SW480 cells,  U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMMGT1 (Membrane Magnesium Transporter 1) is a protein encoded by the MMGT1 gene in humans. It is also known by the aliases EMC5 and TMEM32. This protein is a member of the magnesium transporter family and is involved in the transport of magnesium ions across cell membranes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35121 Product name: Recombinant human MMGT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 65-131 aa of BC033588 Sequence: GEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKLRKLESLRR Predict reactive species\nFull Name: membrane magnesium transporter 1\nCalculated Molecular Weight: 131 aa, 15 kDa\nObserved Molecular Weight: 15-20 kDa\nGenBank Accession Number: BC033588\nGene Symbol: MMGT1\nGene ID (NCBI): 93380\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8N4V1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887721107625,"sku":"31166-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31166-1-ap","provider":"Iright","version":"1.0","type":"link"}