{"product_id":"proteintech-31189-1-ap","title":"Proteintech, 31189-1-AP, UBAP1L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBAP1L (31189-1-AP) by Proteintech is a Polyclonal antibody targeting UBAP1L in WB, ELISA applications with reactivity to human samples\n31189-1-AP targets UBAP1L in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUBAP1L, is a fairly unknown protein. It is predicted to enable ubiquitin binding activity and is believed to be involved in the ubiquitin-dependent protein catabolic process through the multivesicular body sorting pathway. It is also predicted to be part of endosomal sorting complexes required for transport. UBAP1L contains a SOUBA domain, which begins at amino acid residue 269 and extends to the C terminus of the protein. This domain is similar to the one found in UBAP1, where it is known to interact with ubiquitin (PMID: 38293907).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34816 Product name: Recombinant human UBAP1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 92-381 aa of NM_001163692 Sequence: TTIRDPEAGHQERPEEEGEDEAEASSGSEEEPAPSSLQPGSPASPGPGRRLCSLDVLRGVRLELAGARRRLSEGKLVSRPRALLHGLRGHRALSLCPSPAQSPRSASPPGPAPQHPAAPASPPRPSTAGAIPPLRSHKPTVASLSPYTCLPPLGGAPQPLNPHKSHPDTAADLLSALSQEEQDLIGPVVALGYPLRRAIIALQKTGRQSLSQFLSYLSACDRLLRQGYEEGLVDEAMEMFQFSESQAGEFLRLWEQFSDMGFQQDRIKEVLLVHGNRREQALEELVACAQ Predict reactive species\nFull Name: similar to ubiquitin-associated protein 1 (predicted)\nCalculated Molecular Weight: 41 kDa\nObserved Molecular Weight: 41 kDa\nGenBank Accession Number: NM_001163692\nGene Symbol: LOC390595\nGene ID (NCBI): 390595\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: F5GYI3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887913029801,"sku":"31189-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31189-1-ap","provider":"Iright","version":"1.0","type":"link"}