{"product_id":"proteintech-31198-1-ap","title":"Proteintech, 31198-1-AP, KIAA1522 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIAA1522 (31198-1-AP) by Proteintech is a Polyclonal antibody targeting KIAA1522 in IHC, ELISA applications with reactivity to human samples\n31198-1-AP targets KIAA1522 in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human lung squamous cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIt is important to investigate the role of the big protein-coding gene KIAA1522. The mRNA expression of KIAA1522 was elevated in a number of malignancies, according to data from the Gene Expression Atlas and The European Bioinformatics Institute databases, which showed that abnormal KIAA1522 expression may have a role in the pathogenesis and growth of cancer. (PMID: 36761433)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35083 Product name: Recombinant human KIAA1522 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 900-1035 aa of NM_001198972 Sequence: EPRPPQSPASTASFIFSKGSRKLQLERPVSPETQADLQRNLVAELRSISEQRPPQAPKKSPKAPPPVARKPSVGVPPPASPSYPRAEPLTAPPTNGLPHTQDRTKRELAENGGVLQLVGPEEKMGLPGSDSQKELA Predict reactive species\nFull Name: KIAA1522\nCalculated Molecular Weight: 107 kDa\nGenBank Accession Number: NM_001198972\nGene Symbol: KIAA1522\nGene ID (NCBI): 57648\nRRID: AB_3669896\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9P206\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887695515817,"sku":"31198-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31198-1-ap","provider":"Iright","version":"1.0","type":"link"}