{"product_id":"proteintech-31199-1-ap","title":"Proteintech, 31199-1-AP, NCKAP5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NCKAP5 (31199-1-AP) by Proteintech is a Polyclonal antibody targeting NCKAP5 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n31199-1-AP targets NCKAP5 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, HepG2 cells\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNCKAP5 (Nck-associated protein 5), also known as NAP5. NCKAP5 is predicted to be located in cells, especially in nucleoli, Golgi apparatus, cell membrane and cytoplasm. It is widely expressed in many tissues, especially in lung and kidney, and in more than 20 other tissues. And the expression of NCKAP5 was enhanced in oligodendrocytes, oligodendrocyte precursor cells and astrocytes. It may interact with other protein, such as NPM1 and centromere protein complex, and regulate accurate chromosome segregation and distribution. NCKAP5 may be involved in the formation and development of tumors, especially in the process of tumor variation such as ovary and breast cancer. In addition, NCKAP5 may be a diagnostic biomarker in non-small cell lung cancer (NSCLC), which is related to the infiltration of activated B cells, regulatory T cells (Tregs), neutrophils and dendritic cells (PMID: 36628881). The molecular weight of NCKAP5 is 208 kDa, it also has some protein modifications.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35092 Product name: Recombinant human NCKAP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-115 aa of NM_207363 Sequence: MEGKRQLEKRDFGKRLSLDSSLVEYMDSNKYIEHLLTQLEEQHRSLWREKLAVARLQREVAQRTSEGAMHEKLIHELEEERHLRLQSEKRLQEVTLESERNRIQMRSLQQQFSRM Predict reactive species\nFull Name: Nck-associated protein 5\nCalculated Molecular Weight: 209 kDa\nObserved Molecular Weight: 250-260 kDa\nGenBank Accession Number: NM_207363\nGene Symbol: NAP5\nGene ID (NCBI): 344148\nRRID: AB_3669897\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O14513\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887733493929,"sku":"31199-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31199-1-ap","provider":"Iright","version":"1.0","type":"link"}