{"product_id":"proteintech-31200-1-ap","title":"Proteintech, 31200-1-AP, CCDC85C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCDC85C (31200-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC85C in WB, ELISA applications with reactivity to human samples\n31200-1-AP targets CCDC85C in  applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, MCF-7 cells,  MDA-MB-231 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCcdc85c (coiled-coil domain containing 85c) is a gene encoding protein, which is located on human chromosome 14 (14q32.2) and belongs to the helical loop domain protein family. The protein is mainly expressed in the neuroepithelial cells of the lateral ventricle wall of the brain, especially at the top junction of radial glial cells. In addition, it is also expressed in a variety of monolayer epithelial cells, but not in stratified epithelial cells. CCDC85C is the pathogenic gene of hereditary hydrocephalus and subcortical endometriosis (often accompanied by cerebral hemorrhage). In CCDC85C gene knockout (KO) mice and rats, abnormal development of ventricular system was observed, resulting in hydrocephalus and cerebral hemorrhage (PMID: 37271245).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35157 Product name: Recombinant human CCDC85C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 220-390 aa of NM_001144995 Sequence: HHHVPPPLLPPGPHKAPDGKAGATRRSLDDLSAPPHHRSIPNGLHDPSSTYIRQLESKVRLLEGDKLLAQQAGSGEFRTLRKGFSPYHSESQLASLPPSYQDSLQNGPACPAPELPSPPSAGYSPAGQKPEAVVHAMKVLEVHENLDRQLQDSCEEDLSEKEKAIVREMCN Predict reactive species\nFull Name: coiled-coil domain containing 85C\nCalculated Molecular Weight: 419 aa, 45 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: NM_001144995\nGene Symbol: CCDC85C\nGene ID (NCBI): 317762\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: A6NKD9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885981520041,"sku":"31200-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31200-1-ap","provider":"Iright","version":"1.0","type":"link"}