{"product_id":"proteintech-31210-1-ap","title":"Proteintech, 31210-1-AP, TMEM174 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM174 (31210-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM174 in WB, IP, ELISA applications with reactivity to human samples\n31210-1-AP targets TMEM174 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HEK-293T cells,  Jurkat cells\nPositive IP detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTransmembrane protein 174 (TMEM174) is comprised of 243 amino acids, and contains two predicted transmembrane helices which determine its subcellular localization in endoplasmic reticulum and influences its functions (PMID: 20331980). TMEM174) mRNA is easily detectable in human kidney tissues and activates AP-1 and promotes 293T cell proliferation (PMID: 25202393). The Tmem174 protein was extremely highly expressed in the kidney and localized at the apical membrane of the renal proximal tubules. Tmem174 binds to NaPi2a on the cell membrane and is involved in the internalization of NaPi2a (PMID: 35428804). Tmem174 is considered to be a component of the NaPi2a\/NHERF1 complex that receives signals from PTH and FGF23 (PMID: 35428804). This antibody may recognize the dimer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35041 Product name: Recombinant human TMEM174 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-243 aa of BC019346 Sequence: MEQGSGRLEDFPVNVFSVTPYTPSTADIQVSDDDKAGATLLFSGIFLGLVGITFTVMGWIKYQGVSHFEWTQLLGPVLLSVGVTFILIAVCKFKMLSCQLCKESEERVPDSEQTPGGPSFVFTGINQPITFHGATVVQYIPPPYGSPEPMGINTSYLQSVVSPCGLITSGGAAAAMSSPPQYYTIYPQDNSAFVVDEGCLSFTDGGNHRPNPDVDQLEETQLEEEACACFSPPPYEEIYSLPR Predict reactive species\nFull Name: transmembrane protein 174\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC019346\nGene Symbol: TMEM174\nGene ID (NCBI): 134288\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8WUU8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887830978729,"sku":"31210-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31210-1-ap","provider":"Iright","version":"1.0","type":"link"}