{"product_id":"proteintech-31212-1-ap","title":"Proteintech, 31212-1-AP, TSEN34 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TSEN34 (31212-1-AP) by Proteintech is a Polyclonal antibody targeting TSEN34 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n31212-1-AP targets TSEN34 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, HEK-293 cells,  MCF-7 cells,  HeLa cells,  HEK-293T cells\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe human tRNA splicing endonuclease consists of a heterotetramer complex formed by the four TSEN proteins, which were identified by homology with their yeast counterparts. TSEN2 and TSEN34 are the catalytic subunits, which form a compound active site, whereas TSEN54 and TSEN15 are structural proteins. (PMID: 27392077)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35120 Product name: Recombinant human TSEN34 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 52-165 aa of BC020805 Sequence: LMPEEARLLAEIGAVTLVSAPRPDSRHHSLALTSFKRQQEESFQEQSALAAEARETRRQELLEKITEGQAAKKQKLEQASGASSSQEAGSSQAAKEDETSDGQASGEQEEAGPS Predict reactive species\nFull Name: tRNA splicing endonuclease 34 homolog (S. cerevisiae)\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 34-36 kDa\nGenBank Accession Number: BC020805\nGene Symbol: TSEN34\nGene ID (NCBI): 79042\nRRID: AB_3669904\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9BSV6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887840514217,"sku":"31212-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31212-1-ap","provider":"Iright","version":"1.0","type":"link"}