{"product_id":"proteintech-31231-1-ap","title":"Proteintech, 31231-1-AP, LPXN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LPXN (31231-1-AP) by Proteintech is a Polyclonal antibody targeting LPXN in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n31231-1-AP targets LPXN in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MDA-MB-231 cells, PC-3 cells,  RAW 264.7 cells\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLPXN, also known as Leupaxin, LDPL, belongs to the paxillin family. LPXN Contributes to the regulation of cell adhesion, spreading, and cell migration and acts as a negative regulator in integrin-mediated cell adhesion events (PMID: 20543562). LPXN has four leucine-rich LD-motifs in the N-terminus and four LIM domains in the C-terminus. It may function in cell type-specific signaling by associating with PYK2, a member of the focal adhesion kinase family (PMID: 9565592). Studies in breast cancer implicate LPXN is involved in the regulation of ER action as a co-factor (PMID: 25955236). LPXN is expressed in prostate cancer cells and its expression intensity is directly linked to PCa progression (PMID: 18451096).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34956 Product name: Recombinant human LPXN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 5-132 aa of BC019035 Sequence: DALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQLVYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSML Predict reactive species\nFull Name: leupaxin\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 40-50 kDa\nGenBank Accession Number: BC019035\nGene Symbol: LPXN\nGene ID (NCBI): 9404\nRRID: AB_3669911\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O60711\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887706820777,"sku":"31231-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31231-1-ap","provider":"Iright","version":"1.0","type":"link"}