{"product_id":"proteintech-31282-1-ap","title":"Proteintech, 31282-1-AP, FBXO38 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FBXO38 (31282-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO38 in WB, ELISA applications with reactivity to human, mouse samples\n31282-1-AP targets FBXO38 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nF-box containing protein 38 (FBXO38; also known as MoKA) is a substrate receptor for SKP1-CUL1-dependent ubiquitin ligase (SCF). Initially, it was discovered as a modulator of transcription factor Krüppel-like factor 7 (KLF7) activity (PMID: 14729953). In addition, FBXO38 stability is controlled via ubiquitin-specific peptidase 7 (USP7), and FBXO38 protein expression was shown to be required for proper cytokinesis (PMID: 30804394). However, as a ubiquitin ligase, SCFFBXO38 is still insufficiently characterized. So far, the only potential substrate identified is programmed cell death 1 (PD-1) (PMID: 30487606, PMID: 35813202).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35444 Product name: Recombinant human FBXO38 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 490-700 aa of XM_005268513.1 Sequence: SNQNSNNDDNNAQNNNANIHDNNHHHPDDSDEENDFRQDLQPGEQQFAADALNEMEDIVQEDGEVVAESGNNTPAHSQAIIPVDVDEEQAGPSGLQRVVKPTSITVHDSESDDEEDSLELQEVWIPKNGTRRYSEREEKTGESVQSRELSVSGKGKTPLRKRYNSHQMGQSKQFPLEESSCEKGCQVTSEQIKADMKAARDIPEKKKNKDV Predict reactive species\nFull Name: F-box protein 38\nCalculated Molecular Weight: 134kDa，1188aa\nObserved Molecular Weight: 140 kDa, 107 kDa\nGenBank Accession Number: XM_005268513.1\nGene Symbol: FBXO38\nGene ID (NCBI): 81545\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6PIJ6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887636828329,"sku":"31282-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31282-1-ap","provider":"Iright","version":"1.0","type":"link"}