{"product_id":"proteintech-31333-1-ap","title":"Proteintech, 31333-1-AP, COMMD4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COMMD4 (31333-1-AP) by Proteintech is a Polyclonal antibody targeting COMMD4 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n31333-1-AP targets COMMD4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, U2OS cells\nPositive IHC detected in: rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOMMD4 is a protein-coding gene belonging to the COMMD family and is highly expressed in non-small cell lung cancer (NSCLC) and hepatocellular carcinoma (HCC) (PMID: 36249824). It has 3 isoforms and has been shown to control NF-κB activity and regulate the activity of cullin-RING E3 ubiquitin ligases (PMID: 32439936).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34904 Product name: Recombinant human COMMD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-199 aa of BC068998 Sequence: MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG Predict reactive species\nFull Name: COMM domain containing 4\nObserved Molecular Weight: 22-25 kDa\nGenBank Accession Number: BC068998\nGene Symbol: COMMD4\nGene ID (NCBI): 54939\nRRID: AB_3669947\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9H0A8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886782533801,"sku":"31333-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31333-1-ap","provider":"Iright","version":"1.0","type":"link"}