{"product_id":"proteintech-31334-1-ap","title":"Proteintech, 31334-1-AP, EPN2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EPN2 (31334-1-AP) by Proteintech is a Polyclonal antibody targeting EPN2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n31334-1-AP targets EPN2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HepG2 cells,  SH-SY5Y cells\nPositive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEPN2 (EPS 15 interacting protein 2) is a protein that interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. EPN2 is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35194 Product name: Recombinant human EPN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 252-448 aa of BC093972 Sequence: LEESRRDTVKIPKKKEHGSLPQQTTLLDLMDALPSSGPAAQKAEPWGPSASTNQTNPWGGPAAPASTSDPWPSFGTKPAASIDPWGVPTGATAQSVPKNSDPWAASQQPASSAGKRASDAWGAVSTTKPVSVSGSFELFSNLNGTIKDDFSEFDNLRTSKKTAESVTSLPSQNNGTTSPDPFESQPLTVASSKPSSA Predict reactive species\nFull Name: epsin 2\nCalculated Molecular Weight: 584 aa, 62 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC093972\nGene Symbol: EPN2\nGene ID (NCBI): 22905\nRRID: AB_3669948\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O95208\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887615660201,"sku":"31334-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31334-1-ap","provider":"Iright","version":"1.0","type":"link"}