{"product_id":"proteintech-31344-1-ap","title":"Proteintech, 31344-1-AP, CFAP70 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CFAP70 (31344-1-AP) by Proteintech is a Polyclonal antibody targeting CFAP70 in IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n31344-1-AP targets CFAP70 in IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: rat testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCilia- and flagella-associated protein 70 (CFAP70) harbours eight tetratricopeptide repeats (TPRs) and bound tightly to the ciliary axoneme. CFAP70 is necessary to assemble spermatid flagella and could be used as a diagnostic target for male infertility with OAT in the clinic.CFAP70 is a novel regulatory component of the ODA in motile cilia and flagella, and that the N-terminus is important for its ciliary localization (PMID: 30158508).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35209 Product name: Recombinant human TTC18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC032856 Sequence: MEQVPSAGRLVQITVTEGYDLKGFKGDTPVTFIRAEFNQVVLGDSAKITVSPEGSAKYNFTSSFEFNPEGGITSDDLAHKPVFLTVTEVLPKEKKQKEEKTLILGQAVVDLLPLLEGQSSFQTTVPLHPVQGSPLETPRSSAKQCSLEVKVLVAEPLLTTAQISGGNLLKVTLEAAYSVPESFIPTGPGQNYMVGLQVPS Predict reactive species\nFull Name: tetratricopeptide repeat domain 18\nCalculated Molecular Weight: 126 kDa\nObserved Molecular Weight: 126 kDa\nGenBank Accession Number: BC032856\nGene Symbol: TTC18\nGene ID (NCBI): 118491\nRRID: AB_3669954\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5T0N1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886494011561,"sku":"31344-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31344-1-ap","provider":"Iright","version":"1.0","type":"link"}