{"product_id":"proteintech-31387-1-ap","title":"Proteintech, 31387-1-AP, HOXB8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HOXB8 (31387-1-AP) by Proteintech is a Polyclonal antibody targeting HOXB8 in WB, ELISA applications with reactivity to human, mouse, rat samples\n31387-1-AP targets HOXB8 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, HCT 116 cells,  HT-29 cells,  LoVo cells,  mouse epididymis tissue,  rat kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHOXB8, also known as homeobox B8, is a member of the homeobox family. HOXB8 plays a role in the regulation of embryonic development. It helps determine the identity and differentiation of cells along the anterior-posterior axis of the body. ncreased expression of HOXB8 is associated with colorectal cancer. It has been found to enhance the proliferation and metastasis of colorectal cancer cells by promoting epithelial-mesenchymal transition (EMT) via STAT3 activation (PMID: 30622439).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34946 Product name: Recombinant human HOXB8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-134 aa of NM_024016 Sequence: TGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQL Predict reactive species\nFull Name: homeobox B8\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: NM_024016\nGene Symbol: HOXB8\nGene ID (NCBI): 3218\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P17481\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887670481065,"sku":"31387-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31387-1-ap","provider":"Iright","version":"1.0","type":"link"}