{"product_id":"proteintech-31407-1-ap","title":"Proteintech, 31407-1-AP, CMIP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CMIP (31407-1-AP) by Proteintech is a Polyclonal antibody targeting CMIP in WB, IHC, ELISA applications with reactivity to human samples\n31407-1-AP targets CMIP in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, MCF-7 cells,  K-562 cells,  A549 cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCmaf‐inducing protein (CMIP) is a newly identified gene that encodes an 86 kDa protein, containing an N‐terminal pleckstrin homology domain (PH), a nuclear localization signal near the PH domain, a middle region characterized by the presence of several interacting docking sites, including a 14‐3‐3 module, a PKC domain, an Erk domain, an SH3 domain similar to the p85 regulatory subunit of phosphatidylinositol 3‐kinase (PI3K), and a C‐terminal leucine‐rich repeat (LRR) domain.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35679 Product name: Recombinant human CMIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 8-130 aa of BC038113 Sequence: KIYKYKKVLSNPSRWEVVLKEIRTLVDMALTSPLQDDSINQAPLEIVSKLLSENTNLTTQEHENIIVAIAPLLENNHPPPDLCEFFCKHCRERPRSMVVIEVFTPVVQRILKHNMDFGKCPRL Predict reactive species\nFull Name: c-Maf-inducing protein\nCalculated Molecular Weight: 86 kDa\nObserved Molecular Weight: 86 kDa\nGenBank Accession Number: BC038113\nGene Symbol: CMIP\nGene ID (NCBI): 80790\nRRID: AB_3669968\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8IY22\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886651789481,"sku":"31407-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31407-1-ap","provider":"Iright","version":"1.0","type":"link"}