{"product_id":"proteintech-31426-1-ap","title":"Proteintech, 31426-1-AP, UNC79 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UNC79 (31426-1-AP) by Proteintech is a Polyclonal antibody targeting UNC79 in WB, ELISA applications with reactivity to human, mouse, rat samples\n31426-1-AP targets UNC79 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse retina tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUNC79 protein is one of the key auxiliary subunits of the NALCN channel complex. Together with NALCN, FAM155A, and UNC80, it constitutes the NALCN channel body and is essential for maintaining neuronal excitability, motor function, pain sensitivity, and circadian rhythm (PMID: 35387979).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35440 Product name: Recombinant human UNC79 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1740-1860 aa of NM_020818.4 Sequence: PLTLKQKRDLLQKSFALPEMSLDDHPDPGTEGEKPGELMPSSGAKTVLLKVPEDAENPTESEKPDTSAESDTEQNPERKVEEDGAEESEFKIQIVPRQRKQRKIAVSAIQREYLDISFNIL Predict reactive species\nFull Name: KIAA1409\nCalculated Molecular Weight: 295 kDa\nObserved Molecular Weight: 295 kDa\nGenBank Accession Number: NM_020818.4\nGene Symbol: UNC79\nGene ID (NCBI): 57578\nRRID: AB_3669977\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9P2D8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887917322409,"sku":"31426-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31426-1-ap","provider":"Iright","version":"1.0","type":"link"}