{"product_id":"proteintech-31438-1-ap","title":"Proteintech, 31438-1-AP, TMEM109 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM109 (31438-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM109 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n31438-1-AP targets TMEM109 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, HeLa cells,  U-251 cells,  mouse skeletal muscle tissue,  rat heart tissue,  rat skeletal muscle tissue\nPositive IHC detected in: mouse skeletal muscle tissue, mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM109, also known as mg23 or mitsugumin-23, is a transmembrane protein localized to the sarcoplasmic\/endoplasmic reticulum and nuclear membranes. TMEM109 is a ball-shaped cation channel in the sarcoplasmic reticulum (SR).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34866 Product name: Recombinant human TMEM109 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 194-243 aa of BC001309 Sequence: ILYALLSRLTGSRASGAQLEAKVRGLERQVEELRWRQRRAAKGARSVEEE Predict reactive species\nFull Name: transmembrane protein 109\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC001309\nGene Symbol: TMEM109\nGene ID (NCBI): 79073\nRRID: AB_3669983\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9BVC6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887829962921,"sku":"31438-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31438-1-ap","provider":"Iright","version":"1.0","type":"link"}