{"product_id":"proteintech-31442-1-ap","title":"Proteintech, 31442-1-AP, WASF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WASF2 (31442-1-AP) by Proteintech is a Polyclonal antibody targeting WASF2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n31442-1-AP targets WASF2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MDA-MB-231 cells, U2OS cells,  K-562 cells,  MCF-7 cells,  PC-3 cells\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWASF2 (WASp family Verprolin-homologous protein-2), also known as WAVE2, a member of the Wiskott-Aldrich syndrome protein (WASp) family of actin nucleation promoting factors, is a downstream effector molecule that implicates the signal transduction from small GTPases to the actin cytoskeleton, which can elongate the cell movement mode (PMID: 35849030,28332566). Moreover, WASF2 promoted the invasiveness of cancer cells by binding to actin cytoskeletal protein alpha-actinin 4 (ACTN4) (PMID: 30353690). The calculated MW of WASF2 is 54 kDa, with an isoform of 32 kDa, but the observed MW is about 80 kDa, which may be due to post-translational modification (PMID: 35849030,28332566,21383498,17389688,18362183,38391912).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35663 Product name: Recombinant human WASF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 182-315 aa of NM_006990.4 Sequence: KKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGTSGYPPTLVYQNGSIGCVENVDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAPPLGSPPGPKPG Predict reactive species\nFull Name: WAS protein family, member 2\nCalculated Molecular Weight: 54kDa，498aa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: NM_006990.4\nGene Symbol: WASF2\nGene ID (NCBI): 10163\nRRID: AB_3669985\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9Y6W5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887921385641,"sku":"31442-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31442-1-ap","provider":"Iright","version":"1.0","type":"link"}