{"product_id":"proteintech-31454-1-ap","title":"Proteintech, 31454-1-AP, APOE Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe APOE (31454-1-AP) by Proteintech is a Polyclonal antibody targeting APOE in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n31454-1-AP targets APOE in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-251 cells, BV-2 cells,  C2C12 cells,  mouse brain tissue,  mouse skeletal muscle tissue,  mouse cerebellum tissue,  rat brain tissue,  pig cerebellum tissue\nPositive IHC detected in: rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nApolipoprotein E (Apoe) is a core component of plasma lipoproteins that participates in diverse biological processes, including plasma lipoprotein metabolism, intracellular cholesterol utilization, cell growth, immunoregulation, and neuronal growth and repair (PMID: 17854398).  Mouse apoE, like apoE4, contains the equivalent of Arg-112 and Glu-255, but lacks the critical Arg-61 equivalent (it contains Thr-61). Thus, mouse apoE does not display apoE4 domain interaction (PMID: 11553788).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg1093 Product name: Recombinant Mouse APOE protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 19-311 aa of NM_001305819.1 Sequence: EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ Predict reactive species\nFull Name: Apolipoprotein E\nCalculated Molecular Weight: 36kDa\nObserved Molecular Weight: 31~36 kDa\nGenBank Accession Number: NM_001305819.1\nGene Symbol: Apoe\nGene ID (NCBI): 11816\nRRID: AB_3669993\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P08226\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884996677801,"sku":"31454-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31454-1-ap","provider":"Iright","version":"1.0","type":"link"}