{"product_id":"proteintech-31459-1-ap","title":"Proteintech, 31459-1-AP, DAB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DAB1 (31459-1-AP) by Proteintech is a Polyclonal antibody targeting DAB1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n31459-1-AP targets DAB1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig cerebellum tissue, MCF-7 cells\nPositive IHC detected in: mouse cerebellum tissue, mouse brain tissue,  rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDisabled-1 (Dab1) is an adaptor protein that is essential for neuronal migration and maturation in response to the extracellular protein Reelin. DAB1 protein docks to the intracellular part of the Reelin very low density lipoprotein receptor and apoE receptor type 2 and becomes tyrosine-phosphorylated following binding of Reelin to cortical neurons. The DAB1 protein contains a 180-amino acid N-terminal protein interaction\/phosphotyrosine-binding (PTB) 1 domain that docks to the short cytoplasmic tail of the very low density lipoprotein receptor or apoE receptor type 2 at the level of NPXY motifs, with a preference for unphosphorylated motifs. Dab1 polypeptide bands ranging from 36 to 120 kDa have been identified in mouse embryonic brain, the 80-kDa Dab1 being the predominant form (PMID: 24313315).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35376 Product name: Recombinant human DAB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 132-280 aa of NM_021080 Sequence: KEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPVSNGYSFEDFEERFAAATPNRNLPTDFDEIFEATKAVTQLE Predict reactive species\nFull Name: disabled homolog 1 (Drosophila)\nCalculated Molecular Weight: 64 kDa\nObserved Molecular Weight: 45 kDa, 80 kDa\nGenBank Accession Number: NM_021080\nGene Symbol: DAB1\nGene ID (NCBI): 1600\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O75553\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887055032489,"sku":"31459-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31459-1-ap","provider":"Iright","version":"1.0","type":"link"}