{"product_id":"proteintech-31486-1-ap","title":"Proteintech, 31486-1-AP, SLC38A7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC38A7 (31486-1-AP) by Proteintech is a Polyclonal antibody targeting SLC38A7 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n31486-1-AP targets SLC38A7 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC38A7 also known as SNAT7, is a system N transporter with a substrate preference for L-glutamine(PMID: 21511949). SLC38A7 symporter that selectively transports sodium ions and amino acids, such as L-glutamine and L-asparagine from the lysosome into the cytoplasm and may participate in mTORC1 activation (PubMed:28416685, PubMed:35561222). colocalization of Slc38a7 with neuronal markers in excitatory and inhibitory neurons, but not in astrocytes or glial cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35081 Product name: Recombinant human SLC38A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC001961 Sequence: MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGTTST Predict reactive species\nFull Name: solute carrier family 38, member 7\nCalculated Molecular Weight: 50 kDa\nGenBank Accession Number: BC001961\nGene Symbol: SLC38A7\nGene ID (NCBI): 55238\nRRID: AB_3670003\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9NVC3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887806599337,"sku":"31486-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31486-1-ap","provider":"Iright","version":"1.0","type":"link"}