{"product_id":"proteintech-31494-1-ap","title":"Proteintech, 31494-1-AP, PROSER1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PROSER1 (31494-1-AP) by Proteintech is a Polyclonal antibody targeting PROSER1 in IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n31494-1-AP targets PROSER1 in IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPROSER1 (proline- and serine-rich 1) is a chromatin-binding protein encoded by the 13q13.3 locus. It interacts with all three TET enzymes and serves as the core scaffold of the TOPD (TET‑OGT‑PROSER1‑DBHS) complex, stabilizing the binding between TET2 and OGT while promoting O‑GlcNAcylation, thereby enhancing DNA demethylation activity. PROSER1 has recently been found to be associated with neurodevelopmental disorders.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35678 Product name: Recombinant human C13orf23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-178 aa of NM_025138.4 Sequence: MDKKSFEMVLDEIRKAVLTEYKLKAIEYVHGYFSSEQVVDLLRYFSWAEPQLKAMKALQHKMVAVQPTEVVNILNCFTFSKDKLVALELLASNIIDAQNSRPIEDLFRVNMSEKKRCKRILEQAFKGGCKAPHAMISSCGTIPGNPYPKGRPSRINGIFPGTPLKKDGEECTNEGKGI Predict reactive species\nFull Name: chromosome 13 open reading frame 23\nCalculated Molecular Weight: 96kDa，944aa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: NM_025138.4\nGene Symbol: C13orf23\nGene ID (NCBI): 80209\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q86XN7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887774355625,"sku":"31494-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31494-1-ap","provider":"Iright","version":"1.0","type":"link"}