{"product_id":"proteintech-31497-1-ap","title":"Proteintech, 31497-1-AP, ANGPTL4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANGPTL4 (31497-1-AP) by Proteintech is a Polyclonal antibody targeting ANGPTL4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n31497-1-AP targets ANGPTL4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, HEK-293 cells,  rat heart tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells, NIH\/3T3 cells,  HT-29 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAngiopoietin-like protein 4 (ANGPTL4), a member of the angiopoietin-like protein subfamily, is a secretory protein that functions as an important modulator of glucose and lipid metabolism. ANGPTL4 inhibits lipoprotein lipase (LPL)-dependent lipolysis thereby limiting the uptake of free fatty acids. Overexpression of ANGPTL4 results in hypertriglyceridemia, while ANGPTL4 deficiency suppresses foam formation in macrophages and protects against atherosclerosis. ANGPTL4 may play a role in several cancers and it also has been shown to prevent the metastatic process by inhibiting vascular activity as well as tumor cell motility and invasiveness. Decreased expression of this protein has been associated with type 2 diabetes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31212 Product name: Recombinant human ANGPTL4 protein Source: e coli. -derived, PKG Tag: GST Domain: 26-200 aa of BC023647 Sequence: GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSG Predict reactive species\nFull Name: angiopoietin-like 4\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC023647\nGene Symbol: ANGPTL4\nGene ID (NCBI): 51129\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9BY76\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884969873577,"sku":"31497-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31497-1-ap","provider":"Iright","version":"1.0","type":"link"}