{"product_id":"proteintech-31533-1-ap","title":"Proteintech, 31533-1-AP, CXCL8\/IL-8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CXCL8\/IL-8 (31533-1-AP) by Proteintech is a Polyclonal antibody targeting CXCL8\/IL-8 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n31533-1-AP targets CXCL8\/IL-8 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells\nPositive IHC detected in: human tonsillitis tissue, human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PMA, LPS and Brefeldin A treated THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin 8 (IL-8), also known as CXCL8, is a CXC chemokine family member. This chemokine is secreted by a variety of cell types including monocyte\/macrophages, T cells, neutrophils, fibroblasts, endothelial cells, and various tumor cell lines in response to inflammatory stimuli. IL-8 has two primary functions. It induces chemotaxis in target cells, primarily neutrophils but also other granulocytes, causing them to migrate toward the site of infection. IL-8 also induces phagocytosis once they have arrived. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. IL-8 is also known to be a potent promoter of angiogenesis. IL-8 has been associated with tumor angiogenesis, metastasis, and poor prognosis in breast cancer. IL-8 may present a novel therapeutic target for estrogen driven breast carcinogenesis and tumor progression. The human IL-8 cDNA sequence predicts a protein of 99 amino acids. Removal of a 22-residue signal peptide generates a mature protein of 77 amino acids (~ 8 kDa).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg0152 Product name: Recombinant Human CXCL8\/IL-8 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc \u0026amp; 6*His Domain: 28-99 aa of BC013615 Sequence: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS Predict reactive species\nFull Name: interleukin 8\nCalculated Molecular Weight: 99 aa, 11 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC013615\nGene Symbol: IL-8\nGene ID (NCBI): 3576\nENSEMBL Gene ID: ENSG00000169429\nRRID: AB_3670024\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P10145\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886967804073,"sku":"31533-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31533-1-ap","provider":"Iright","version":"1.0","type":"link"}