{"product_id":"proteintech-31586-1-ap","title":"Proteintech, 31586-1-AP, RASA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RASA2 (31586-1-AP) by Proteintech is a Polyclonal antibody targeting RASA2 in IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n31586-1-AP targets RASA2 in IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: Jurkat cells, A431 cells\nPositive IHC detected in: human Hepatocellular carcinomaNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRas GTPase-activating protein 2 (RASA2) is also named GAP1M and RASGAP.  RASA2 was a critical RAS-specific GAP, inhibition of which permitted increased proliferation following TCR stimulation under conditions of immunosuppression (PMID: 37858490). RASA2 was identified as an inhibitor of RAS signaling in multiple human tumors, including melanoma, where inactivating RASA2 mutations have been found (PMID: 26502337). RASA2 is also one of the genes mutated in Noonan syndrome, a Rasopathy associated with developmental defects and elevated RAS activity (PMID: 25049390). RASA2 is expressed in both CD4+ and CD8+ T cells (PMID: 36002574).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35885 Product name: Recombinant human RASA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 700-850 aa of NM_001303245 Sequence: VLCRVSRCNQNRLSFYHPSVYLNGNWLCCQETGENTLGCKPCTAGVPADIQIDIDEDRETERIYSLFTLSLLKLQKMEEACGTIAVYQGPQKEPDDYSNFVIEDSVTTFKTIQQIKSIIEKLDEPHEKYRKKRSSSAKYGSKENPIVGKAS Predict reactive species\nFull Name: RAS p21 protein activator 2\nCalculated Molecular Weight: 96kDa\nObserved Molecular Weight: 97 kDa\nGenBank Accession Number: NM_001303245\nGene Symbol: RASA2\nGene ID (NCBI): 5922\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q15283\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887779500201,"sku":"31586-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31586-1-ap","provider":"Iright","version":"1.0","type":"link"}