{"product_id":"proteintech-31588-1-ap","title":"Proteintech, 31588-1-AP, CNTD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CNTD2 (31588-1-AP) by Proteintech is a Polyclonal antibody targeting CNTD2 in WB, ELISA applications with reactivity to human samples\n31588-1-AP targets CNTD2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCNTD2, also known as Cyclin N-terminal domain containing 2 or CCNP, is a protein that has been implicated in cancer cell proliferation and migration, particularly in colon and lung cancers . It is an atypical cyclin that contains a cyclin box domain, which is a characteristic feature of cyclin-dependent kinase (CDK) binding partners. CNTD2 is considered an atypical cyclin due to its structural specificities, which were revealed through the human genome sequence project (PMID: 30087414). The apparent molecular mass measured by SDS-PAGE is 25 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36380 Product name: Recombinant human CNTD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_024877 Sequence: MLVRGRDQGSGSRLGPIVRRWAPRPSPLQSLAASLDAEPSSAAVPDGFPAGPTVSPRRLARPPGLEEALSALGLQGEREYAGDIFAEVMVCRVLPLRALP Predict reactive species\nFull Name: cyclin N-terminal domain containing 2\nCalculated Molecular Weight: 33kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: NM_024877\nGene Symbol: CNTD2\nGene ID (NCBI): 79935\nRRID: AB_3670047\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9H8S5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886695207081,"sku":"31588-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31588-1-ap","provider":"Iright","version":"1.0","type":"link"}