{"product_id":"proteintech-31628-1-ap","title":"Proteintech, 31628-1-AP, VLGR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VLGR1 (31628-1-AP) by Proteintech is a Polyclonal antibody targeting VLGR1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n31628-1-AP targets VLGR1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, SH-SY5Y cells\nPositive IP detected in: SH-SY5Y cells\nPositive IHC detected in: human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVLGR1 (very large G protein-coupled receptor-1), also known as ADGRV1, GPR98, and MASS, has a molecular weight of up to 700 kDa, making it the largest member of the 33 adhesive G protein-coupled receptors (ADGRs), a unique subfamily of the GPCR superfamily. The full-length VLGR1 encompasses ∼6300 amino acids and thus is difficult to analyze by electrophoresis. Vlgr1 is a core component of ankle-link complex in inner ear hair cells. Knock-out and mutation mouse models show that loss of Vlgr1 function leads to abnormal stereociliary development and hearing loss, indicating crucial roles of Vlgr1 in hearing transduction or auditory system development (PMID: 23180093). Western blot analysis detected VLGR1a isoform at an apparent molecular mass of 217 kDa .\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34635 Product name: Recombinant human ADGRV1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2269-2812 aa of NM_032119 Sequence: ESIIVSLVYTEGGSRILPSSDTVRVNILANDNVAGIVSFQTASRSVIGHEGEILQFHVIRTFPGRGNVTVNWKIIGQNLELNFANFSGQLFFPEGSLNTTLFVHLLDDNIPEEKEVYQVILYDVRTQGVPPAGIALLDAQGYAA Predict reactive species\nFull Name: G protein-coupled receptor 98\nCalculated Molecular Weight: 693 kDa\nObserved Molecular Weight: 217 kDa\nGenBank Accession Number: NM_032119\nGene Symbol: GPR98\nGene ID (NCBI): 84059\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8WXG9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887920140457,"sku":"31628-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31628-1-ap","provider":"Iright","version":"1.0","type":"link"}