{"product_id":"proteintech-31658-1-ap","title":"Proteintech, 31658-1-AP, dysferlin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe dysferlin (31658-1-AP) by Proteintech is a Polyclonal antibody targeting dysferlin in WB, ELISA applications with reactivity to human, mouse, rat samples\n31658-1-AP targets dysferlin in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDysferlin, also known as FER1L1, belongs to the ferlin family and is a member of a putative muscle-specific repair complex. It has many isoforms and is a large membrane protein that is most abundant in striated muscle. It plays a role in sarcolemmal repair and is a key calcium ion sensor involved in Ca(2+)-triggered synaptic vesicle-plasma membrane fusion.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35810 Product name: Recombinant human dysferlin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-210 aa of NM_001130455 Sequence: DQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTPLPGAVPLFPPPTPLEPSPTLPDLDVVADTGGEEDTEDQGLTGDEAEPFLDQSGGPGAPTTPRKLPSRPPPHYPGIKRKRSAPTSR Predict reactive species\nFull Name: dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive)\nCalculated Molecular Weight: 237 kDa\nObserved Molecular Weight: 240 kDa\nGenBank Accession Number: NM_001130455\nGene Symbol: DYSF\nGene ID (NCBI): 8291\nRRID: AB_3670065\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O75923\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887393525929,"sku":"31658-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31658-1-ap","provider":"Iright","version":"1.0","type":"link"}