{"product_id":"proteintech-31669-1-ap","title":"Proteintech, 31669-1-AP, EPB41L4B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EPB41L4B (31669-1-AP) by Proteintech is a Polyclonal antibody targeting EPB41L4B in WB, ELISA applications with reactivity to Human samples\n31669-1-AP targets EPB41L4B in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, HEK-293T cells,  MCF-7 cells,  U-87 MG cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe 4.1 proteins, encoded by the EPB41 (erythrocyte protein band 4.1) genes, are components of the cortical cytoskeleton underlying the cell membrane. The family of 4.1 proteins consists of the eponymous 4.1R protein first identified in erythrocytes (gene: EPB41), 4.1N (EPB41L1), 4.1G (EPB41L2), 4.1B (EPB41L3) as well as the less closely related members NBL4 (EPB41L4A), EHM2 (EPB41L4B) and EPB41L5 (EPB41L5). EHM2 is conspicuous in tumor cells with high migratory potential, such as metastatic melanoma and fibrosarcoma cells. In prostate cancer, EHM2 has been reported to be overexpressed and to diminish adhesion of prostate cancer cells to collagen. (PMID: 20860828)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36353 Product name: Recombinant human EPB41L4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 550-700 aa of NM_00138562 Sequence: TPALFSEAAAHLKKLELETVKAAGPWPPLHININKAEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRVNIQGGKEESPFVNINKKSSLQDASVRSPIPIRVETAQPAVEKPEIKPPRVRKLTRQYSFDEDDLPPDLAEAVGVTTS Predict reactive species\nFull Name: erythrocyte membrane protein band 4.1 like 4B\nCalculated Molecular Weight: 99kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: NM_00138562\nGene Symbol: EPB41L4B\nGene ID (NCBI): 54566\nRRID: AB_3670069\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9H329\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887579680937,"sku":"31669-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31669-1-ap","provider":"Iright","version":"1.0","type":"link"}