{"product_id":"proteintech-31683-1-ap","title":"Proteintech, 31683-1-AP, CIZ1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CIZ1 (31683-1-AP) by Proteintech is a Polyclonal antibody targeting CIZ1 in WB, ELISA applications with reactivity to human samples\n31683-1-AP targets CIZ1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  Jurkat cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCIZ1, also known as LSFR1 and ZNF356, is a nuclear protein and the binding partner of p21. The full-length CIZ1 consists of 842 amino acid (aa) residues and contains two glutamine-rich domains, three C2H2-type zinc finger motifs, one acidic domain, and one MH3 domain (PMID: 10529385). Dysregulated or point mutated CIZ1 has been implicated in neurodegenerative, autoimmune and cancer diseases.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35418 Product name: Recombinant human CIZ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 126-350 aa of BC021163 Sequence: FFPQATRQSLLGPPPVGVPMNPSQFNLSGRNPQKQARTSSSTTPNRKDSSSQTMPVEDKSDPPEGSEEAAEPRMDTPEDQDLPPCPEDIAKEKRTPAPEPEPCEASELPAKRLRSSEEPTEKEPPGQLQVKAQPQARMTVPKQTQTPDLLPEALEAQVLPRFQPRVLQVQAQVQSQTQPRIPSTDTQVQPKLQKQAQTQTSPEHLVLQQKQVQPQLQQEAEPQKQ Predict reactive species\nFull Name: CDKN1A interacting zinc finger protein 1\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: BC021163\nGene Symbol: CIZ1\nGene ID (NCBI): 25792\nRRID: AB_3670077\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9ULV3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886588448937,"sku":"31683-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31683-1-ap","provider":"Iright","version":"1.0","type":"link"}