{"product_id":"proteintech-31700-1-ap","title":"Proteintech, 31700-1-AP, CWF19L1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CWF19L1 (31700-1-AP) by Proteintech is a Polyclonal antibody targeting CWF19L1 in WB, ELISA applications with reactivity to human samples\n31700-1-AP targets CWF19L1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCWF19L1 belongs to the CWF19 family. CWF19L1 includes a metallophosphatase (MMP) domain, a histidine triad motif (HIT) domain, and a C-terminal Cwf-J-C domain. CWF19L1 is believed to be involved in cell cycle control, endosomal trafficking, and mRNA processing. CWF19L1 is a rare cause of autosomal recessive cerebellar ataxias (ARCA) (PMID: 36357319, PMID: 36453471). CWF19L1 is expressed in many brain regions, including cerebellum, thalamus and occipital, parietal and temporal lobes. CWF19L1 is also expressed in the spinal cord (PMID: 25361784).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36356 Product name: Recombinant human CWF19L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 325-538 aa of BC008746 Sequence: PGPCWFCLASPEVEKHLVVNIGTHCYLALAKGGLSDDHVLILPIGHYQSVVELSAEVVEEVEKYKATLRRFFKSRGKWCVVFERNYKSHHLQLQVIPVPISCSTTDDIKDAFITQAQEQQIELLEIPEHSDIKQIAQPGAAYFYVELDTGEKLFHRIKKNFPLQFGREVLASEAILNVPDKSDWRQCQISKEDEETLARRFRKDFEPYDFTLDD Predict reactive species\nFull Name: CWF19-like 1, cell cycle control (S. pombe)\nObserved Molecular Weight: 60-65 kDa\nGenBank Accession Number: BC008746\nGene Symbol: CWF19L1\nGene ID (NCBI): 55280\nRRID: AB_3670086\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q69YN2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886950174889,"sku":"31700-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31700-1-ap","provider":"Iright","version":"1.0","type":"link"}